2. Cardiovascular Disease

Cardiovascular Disease

Cardiovascular Disease

Related Products

PDF 32.36 MB

Cardiovascular diseases (CVDs) are the leading causes of death and disability worldwide. CVDs include diseases of the heart, vascular diseases of the brain and diseases of blood vessels. Caused by atherosclerosis, coronary heart disease and cerebrovascular disease are the most common forms of CVDs. Other less common forms of CVDs include rheumatic heart disease and congenital heart disease. A large percentage of CVDs is preventable through the reduction of behavioral risk factors such as tobacco use, physical inactivity and unhealthy diet. Dietary sodium reduction can alleviate the long-term risk of cardiovascular disease events. Statin therapy is an effective intervention in both the primary and secondary preventions of CVDs in those who are at high risk.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-P1235
    Carperitide 89213-87-6 98%
    Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
    Carperitide
  • HY-P1490
    Bradykinin (2-9) 16875-11-9
    Bradykinin (2-9) is an amino-truncated Bradykinin peptide. Bradykinin (2-9) is a metabolite of Bradykinin, cleaved by Aminopeptidase P.
    Bradykinin (2-9)
  • HY-P1495
    Small Cardioactive Peptide B (SCPB) 84746-43-0 99.69%
    Small Cardioactive Peptide B (SCPB), a neurally active peptide, stimulates adenylate cyclase activity in particulate fractions of both heart and gill tissues with EC50s of 0.1 and 1.0 μM, respectively.
    Small Cardioactive Peptide B (SCPB)
  • HY-P1516
    Angiogenin (108-122) 112173-49-6 98%
    Angiogenin (108-122) is an angiogenin peptide.
    Angiogenin (108-122)
  • HY-P1542
    Urotensin I 83930-33-0 98%
    Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.
    Urotensin I
  • HY-P1798
    Platelet Factor 4 (58-70), human 82989-21-7 99.89%
    Platelet Factor 4 (58-70), human, a peptide based on the amino acid sequence corresponding to residues 58-70 of platelet factor-4 (PF-4), contains the major heparin-binding domain, which is not sufficient for full antiangiogenic activity.
    Platelet Factor 4 (58-70), human
  • HY-P1838
    Proadrenomedullin (45-92), human 166798-69-2 99.77%
    Proadrenomedullin (45-92), human is a peptide corresponding to amino acids 45-92 of human preproadrenomedullin. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.
    Proadrenomedullin (45-92), human
  • HY-P1858
    Urocortin III, mouse 357952-10-4 98.29%
    Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.
    Urocortin III, mouse
  • HY-P2196
    ELA-32(human) 1680205-79-1 98%
    ELA-32 (human) is a potent critical cardiac developmental peptide that acts through the G-protein–coupled apelin receptor.
    ELA-32(human)
  • HY-P2281
    Atrial natriuretic factor (1-28) (human, porcine) 91917-63-4 98%
    Atrial natriuretic factor (1-28) (human, porcine) exhibits blood pressure lowering activity by increasing sodium and urine excretion. Atrial natriuretic factor (1-28) (human, porcine) inhibits the release of pituitary adrenocorticotropic hormone (ACTH) and beta-endorphin through inhibition of pro-opiomelanocortin (POMC) expression. Atrial natriuretic factor (1-28) (human, porcine) increases cGMP levels in RMIC cells with an IC50 of 1.2 nM.
    Atrial natriuretic factor (1-28) (human, porcine)
  • HY-P2933
    Activated protein C 42617-41-4
    Activated protein C is an anticoagulant targeting coagulation factors Va and VIIIa. Activated protein C demonstrates cytoprotective effects through binding to endothelial cell protein C receptor (EPCR) and protease-activated receptor-1 (PAR-1), regulating gene expression, anti-inflammation, anti-apoptosis, and stabilizing endothelial barriers. Activated protein C is promising for research of diseases such as severe sepsis and ischemic stroke.
    Activated protein C
  • HY-P2936
    Sphingomyelin phosphodiesterase, Streptomyces sp. 9031-54-3
    Sphingomyelin phosphodiesterase, Streptomyces sp. is a sphingomyelin phosphodiesterase derived from the genus Streptomyces, which cleaves the phosphodiester bond of sphingomyelin. Sphingomyelin phosphodiesterase, Streptomyces sp. catalyzes the hydrolysis of sphingomyelin in micelles, synthetic substrates, erythrocyte ghost membranes and liposomes, as well as the hydrolysis of the substrate HNP. In the presence of Mg2+ or Mn2+ , Sphingomyelin phosphodiesterase, Streptomyces sp. induces hemolysis of bovine erythrocytes through the hydrolysis of membrane sphingomyelin.
    Sphingomyelin phosphodiesterase, Streptomyces sp.
  • HY-P3019
    Urocortin III (human) 357952-09-1 98%
    Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) potently binds to type 2 CRF receptors, specifically mCRF2β (Ki = 13.5 nM) and rCRF2α (Ki = 21.7 nM), while demonstrating negligible affinity for hCRF1 (Ki >100 nM). Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion[1][2].
    Urocortin III (human)
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-P3429
    SAMβA 2429946-75-6 99.14%
    SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats.
    SAMβA
  • HY-P3460
    TDSRCVIGLYHPPLQVY 887973-01-5
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order.
    TDSRCVIGLYHPPLQVY
  • HY-P3533
    EILEVPST 239075-62-8 98.99%
    EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis.
    EILEVPST
  • HY-P3910
    [Val4] Angiotensin III 100900-28-5 98.51%
    [Val4] Angiotensin III is an angiotension III peptide. [Val4] Angiotensin III is a potent full agonist of Gαq and βarr2 response, with pEC50 values of 8.31 and 8.44, respectively.
    [Val4] Angiotensin III
  • HY-P3976
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine 198284-23-0 99.78%
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure.
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
  • HY-P3985
    Bradykinin potentiator B 30892-86-5 99.94%
    Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.
    Bradykinin potentiator B
Cat. No. Product Name / Synonyms Application Reactivity